PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g36370.1.p
Common NameBRADI_3g36370, LOC100830949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 287aa    MW: 32070.5 Da    PI: 4.7975
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g36370.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.4e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lv  +   G  +W+++++  g+ R++k+c++rw +yl
  Bradi3g36370.1.p 14 KGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding50.83.9e-1671111547
                       -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ +++l vd+++qlG++ W++Ia+ ++ gRt++++k++w+++
  Bradi3g36370.1.p  71 SEADEKLVVDLHAQLGNR-WSKIASQLP-GRTDNEIKNHWNTH 111
                       7889**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-19563IPR009057Homeodomain-like
PROSITE profilePS5129414.15961IPR017930Myb domain
SuperFamilySSF466891.24E-2511108IPR009057Homeodomain-like
SMARTSM007174.7E-111363IPR001005SANT/Myb domain
PfamPF002492.3E-131461IPR001005SANT/Myb domain
CDDcd001676.77E-81661No hitNo description
PROSITE profilePS5129425.64362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2364116IPR009057Homeodomain-like
SMARTSM007174.7E-1466114IPR001005SANT/Myb domain
PfamPF002491.2E-1370111IPR001005SANT/Myb domain
CDDcd001671.33E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFIL GNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEADEKLVVD LHAQLGNRWS KIASQLPGRT DNEIKNHWNT HIKKKLRKLG  120
IDPLTHKPLP VPDQKLPEQE KKTESTETGT DLQRDGDDQE EEELVLLKKS PGFCTDDVPM  180
LHPDEIVVPL SPPPPTSSYC SSSSASTSCD DGTTLFPIMD MDWPDSGTMC LMGLEDDMIF  240
MAAPWEEDCL LAPQPQSADT FSAYQCQRNS AALVEQQEAW NKLELF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0362291e-147BT036229.1 Zea mays full-length cDNA clone ZM_BFb0101M11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572214.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX64e-83ODO1_PETHY; Protein ODORANT1
TrEMBLI1I7770.0I1I777_BRADI; Uncharacterized protein
STRINGBRADI3G36370.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.19e-89myb domain protein 43